DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Mcpt1l3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038949770.1 Gene:Mcpt1l3 / 408209 RGDID:1302933 Length:270 Species:Rattus norvegicus


Alignment Length:267 Identity:85/267 - (31%)
Similarity:117/267 - (43%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLAS 210
            |.|.:.|...|:||.:...:::|.|.: |||.|||.:||||||||    ......|.:|..|:: 
  Rat    44 GGVESIPHSRPYMAHLKITTEKGYVTF-CGGFLISRQFVLTAAHC----NGREITVTLGAHDVS- 102

  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL-----PTTI 270
             ||....|.|::|:...|.||.......||.||||||:||||..|..|.|   |..     |.|:
  Rat   103 -KRESTQQKLKVEKQIIHKNYNFFSNIHDIMLLKLEKQVELTPAVDVVPL---PSPSDFIDPGTM 163

  Fly   271 AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA--QDYILNRDTC 333
            ..|.|:|.|....|.:...|                  |.|....:::.:.|.  .||..|...|
  Rat   164 CQAAGWGQTGVTDPTSYTYT------------------LREVELRIMDVEACKIFSDYDYNFQMC 210

  Fly   334 -----------QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR--SSYPSVYTRVSSFLDW 385
                       :|||||||..       ....|    ||.|:|   |  :..|:|:||:|.::.|
  Rat   211 VGSPGRMRSPYEGDSGGPLLC-------AGVAH----GIVSHG---REDAKPPAVFTRISPYVPW 261

  Fly   386 IELTVWA 392
            |.:.:.|
  Rat   262 INIVLSA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/260 (32%)
Tryp_SPc 146..386 CDD:214473 82/259 (32%)
Mcpt1l3XP_038949770.1 Tryp_SPc 42..263 CDD:238113 83/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.