DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG14088

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:230 Identity:65/230 - (28%)
Similarity:97/230 - (42%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GSLISERFVLTAAHCTS----IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMY 236
            |:||.|||:||..||..    |.....::.|||. :|| |...|.|       .|::.|:..:..
  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGS-ELA-EDHIVAA-------FFSNANFNPETQ 115

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGY--GAT---SFAKPMTNRLTNLNLTV 296
            .:::.|:||.:.|...|::.||.:.:...: .|.|..:.|  |.|   |...||....|.:.:  
  Fly   116 ANNMGLMKLLRTVVYKEHIIPVCILMDSRM-QTFADELDYFNGTTWKNSDKSPMLRSKTVIRM-- 177

  Fly   297 VPNAECNAELPPLAETPSGVLE-SQICAQDYILNRDTCQGDSGGPL--QLNLPGRRRGHRIHYHL 358
             |.| |            |.|: .|.||....|  |:|...||..|  :::..|..|     ..|
  Fly   178 -PQA-C------------GKLDHGQFCAGHKDL--DSCDEPSGAALTREIDYIGPNR-----TVL 221

  Fly   359 IGI-TSYGVFCRSSYPSVYTRVSSFLDWIELTVWA 392
            .|| .|..|.|.:|  ..||.|.....||.:.:::
  Fly   222 FGIANSVEVKCSNS--RTYTDVVQLHQWISMVIYS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/223 (29%)
Tryp_SPc 146..386 CDD:214473 63/222 (28%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 65/225 (29%)
Tryp_SPc 42..248 CDD:214473 63/222 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.