DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG4998

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:426 Identity:101/426 - (23%)
Similarity:163/426 - (38%) Gaps:124/426 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSNTHTQRLPPEGR------MRPLQDDSIRSP-----VDRDIVFPELDAGPGKPEEKMWFHITDF 71
            :|...|.|....||      :.||.:....:|     .|| |.||. |......|:.:|      
  Fly   821 VSGGDTDRPSNSGRRGKQLNLGPLYNIPTPAPGEAAGSDR-ITFPR-DRRRRSVEDGVW------ 877

  Fly    72 QFDRVEGPTQPKPKPRQYPPPPM-------------PGQPFPPPPG----GFKKKENKQRRLCEQ 119
                  ....||.:...|...|:             |.:|..||..    |.:.......|:   
  Fly   878 ------AGAAPKEQRAYYGNRPVEKTCRINEVCCRRPLRPQAPPQQFGRCGVRNAAGITGRI--- 933

  Fly   120 KYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFV 184
            |...||:             .|::|        ||||...|: .:.|..:..|.|||:||..:.:
  Fly   934 KNPVYVD-------------GDSEF--------GEYPWHVAI-LKKDPKESIYACGGTLIDAQHI 976

  Fly   185 LTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEV 249
            ::||||..........||:|:.|:..:..........:..|..||.|......:|:|:|||::.|
  Fly   977 ISAAHCIKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPV 1041

  Fly   250 ELTE--YVRP------------VRLWVFPELPTTIAFAMGYGATSFAK--PMTNRLTNLNLTVVP 298
            :.|:  ::.|            .|.|      ||     |:|..:|.:  ...|.|..:::.::.
  Fly  1042 DFTKNPHISPACLPDKYSDFTGARCW------TT-----GWGKDAFGEHGKYQNILKEVDVPILS 1095

  Fly   299 NAECNAELPPLAETPSGVLESQICAQDYILN-----------RDTCQGDSGGPLQLNLPGRRRGH 352
            :.:|.::   |..|..|        ..|.||           :|.|:||.||||..:..|.    
  Fly  1096 HQQCESQ---LRNTRLG--------YSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNGA---- 1145

  Fly   353 RIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
               .|::|:.|:|:.| :.:.|.||.:||::|.||:
  Fly  1146 ---MHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQ 1178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/268 (26%)
Tryp_SPc 146..386 CDD:214473 68/267 (25%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 72/275 (26%)
Tryp_SPc 942..1177 CDD:214473 70/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.