DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and ovch1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:229 Identity:77/229 - (33%)
Similarity:119/229 - (51%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKW---VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM 235
            |||:::.:.:|:||.||...|:.|..|   |.:.:||.|:|.   ..:.::::::|:|.||.:|.
Zfish    82 CGGAILDQLWVITAGHCFKRYKKPSMWNAVVGLHNLDNANES---SRESIQVQKIFSHKNYNQKT 143

  Fly   236 YYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNA 300
            ..:|||||||:..:..:::|||:.::.....|.......|:|:.:...|..:||..:|:||....
Zfish   144 NENDIALLKLQSPLVFSKFVRPIGVFNNDLPPLVTCTVTGWGSVTENGPQASRLQEVNVTVYEPQ 208

  Fly   301 ECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG 365
            :||...      ...||:|.|||.......|.|||||||||.. ..|.|      |.|.|:.|:|
Zfish   209 KCNRFY------RGKVLKSMICAGANEGGMDACQGDSGGPLSC-FDGER------YKLAGVVSWG 260

  Fly   366 VFC-RSSYPSVYTRVSSFLDWI------ELTVWA 392
            |.| |:..|.|||.:..:..|:      ||.|.|
Zfish   261 VGCGRAQKPGVYTTLYHYRQWMVSSMRGELAVEA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/222 (33%)
Tryp_SPc 146..386 CDD:214473 72/215 (33%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 72/214 (34%)
Tryp_SPc 57..281 CDD:238113 72/214 (34%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.