DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and teq

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648288.2 Gene:teq / 39048 FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster


Alignment Length:347 Identity:89/347 - (25%)
Similarity:142/347 - (40%) Gaps:90/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCE----QKYSEYVER-----IFPND-TAVA 136
            |.|:.::|....:.|       |....:|...:...:    ::.|:.|..     ||.:| |...
  Fly  2483 PPPRSQRYSQTQIKG-------GRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEY 2540

  Fly   137 ADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAP--PK 199
            |...:....|.| |:.|.:|..|.:......|...:.||..:||:|.:||||||  :|.:|  ..
  Fly  2541 AHREERVVRGNV-AQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHC--LYGSPKGAY 2602

  Fly   200 WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYY-DDIALLKLEKEVELTEYVRPVRLWVF 263
            :||:|| ..|:...|.|.... ||..:.|.|::|..:. :||||:.|:..::.::||:|:     
  Fly  2603 FVRVGD-HYANIAESSEVDSF-IENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPI----- 2660

  Fly   264 PELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC--------------------NAELPP 308
                                    .|.:.|..:|.:.:|                    :||||.
  Fly  2661 ------------------------CLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPI 2701

  Fly   309 LAE--------TPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG 365
            ||:        ..|.:.|...||.....:.|.|:|||||||..:......       |.|:.|:|
  Fly  2702 LADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGET-------LYGLISWG 2759

  Fly   366 VFCR-SSYPSVYTRVSSFLDWI 386
            ..|. .:.|.||.||:.::|||
  Fly  2760 QHCGFKNRPGVYVRVNHYIDWI 2781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/273 (28%)
Tryp_SPc 146..386 CDD:214473 74/271 (27%)
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555
SRCR 2386..2480 CDD:278931
Tryp_SPc 2546..2781 CDD:214473 74/275 (27%)
Tryp_SPc 2547..2784 CDD:238113 76/276 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.