DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:264 Identity:80/264 - (30%)
Similarity:122/264 - (46%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW 200
            |:.:......||..|..||:|..|::.....    .::||.||||..::||||||....:.|.:|
Human   199 ASSSTQRIVQGRETAMEGEWPWQASLQLIGS----GHQCGASLISNTWLLTAAHCFWKNKDPTQW 259

  Fly   201 VRI--GDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVF 263
            :..  ..:...:.||:|       .::..|.||.::...:||||::|...||.:..|:.|.|   
Human   260 IATFGATITPPAVKRNV-------RKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCL--- 314

  Fly   264 PEL-----PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECN-AELPPLAETP----SGVLE 318
            |:.     |.|..|..|:|:.....|:.|.|....:..:....|| .::.....||    :|.:|
Human   315 PDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDGLITPGMLCAGFME 379

  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSF 382
            .:|         |.|:|||||||..:      .|.|.| ::||.|:|..|. ...|.|||||:.:
Human   380 GKI---------DACKGDSGGPLVYD------NHDIWY-IVGIVSWGQSCALPKKPGVYTRVTKY 428

  Fly   383 LDWI 386
            .|||
Human   429 RDWI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/254 (31%)
Tryp_SPc 146..386 CDD:214473 77/252 (31%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 77/256 (30%)
Tryp_SPc 206..435 CDD:238113 79/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.