DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG6592

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:141/287 - (49%) Gaps:29/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDY 172
            ::::::..:...:.:..:|::.|.    .|.|.|..|.|.| ..|..:|:...:..:..:|.  |
  Fly    92 EEDDREPLVLNLETTPLMEKMLPE----GAMAMDRIFGGDV-GNPHCFPYQVGMLLQRPKGL--Y 149

  Fly   173 KCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYY 237
            .|||||||::.|:|||||..:.:....::...::..|.||..|.. ::..|....:|.:..|...
  Fly   150 WCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRL-MVPSENFQIYPTWNPKRLK 213

  Fly   238 DDIALLKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMGYG--ATSFAKPMTNRLTNLNLTV 296
            ||||:::|...|...|.:.|::|    :.:......:|.|.|:|  ||. ...::|.|..:.|.:
  Fly   214 DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATG-VHAISNVLRYVQLQI 277

  Fly   297 VPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGI 361
            :....|.:.. ||:...:.:..|...|      |.||.|||||||.|     :|.|.....|:||
  Fly   278 IDGRTCKSNF-PLSYRGTNICTSGRNA------RSTCNGDSGGPLVL-----QRRHSKKRVLVGI 330

  Fly   362 TSYGVF--CRSSYPSVYTRVSSFLDWI 386
            ||:|..  |...||:.:|:|:|:||||
  Fly   331 TSFGSIYGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/249 (31%)
Tryp_SPc 146..386 CDD:214473 76/247 (31%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 77/251 (31%)
Tryp_SPc 123..359 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.