DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG1299

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:339 Identity:97/339 - (28%)
Similarity:148/339 - (43%) Gaps:84/339 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRL------CEQKYSEYVERIFPNDTAV 135
            :|.|...|.|.|..|               |..:...|||      |..... |.::|.      
  Fly   220 QGITNTTPAPSQIVP---------------KNTDEIPRRLLNVEEGCGSTVG-YFKKIV------ 262

  Fly   136 AADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW 200
                      |..::|.|.:|.:|.:|::...|. .:||||:||:.|.|||||||   .....::
  Fly   263 ----------GGEVSRKGAWPWIALLGYDDPSGS-PFKCGGTLITARHVLTAAHC---IRQDLQF 313

  Fly   201 VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE 265
            ||:|:.||:::..:.... :.|.:..:||:|.::....|:|:|.||:.||.|..:.|:.      
  Fly   314 VRLGEHDLSTDTETGHVD-INIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPIC------ 371

  Fly   266 LPTT-----------IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC-----------NAELPP 308
            ||.|           :.|..|:|.|.........|..|.:.:..|..|           :|:...
  Fly   372 LPHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFD 436

  Fly   309 LAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSY 372
            .|...:|||..         .:|||||||||||.  ||...:| ::.::|||:.|||:.| |.:.
  Fly   437 KAVLCAGVLSG---------GKDTCQGDSGGPLM--LPEPYQG-QLRFYLIGVVSYGIGCARPNV 489

  Fly   373 PSVYTRVSSFLDWI 386
            |.||:....|:|||
  Fly   490 PGVYSSTQYFMDWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 84/264 (32%)
Tryp_SPc 146..386 CDD:214473 82/262 (31%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 83/281 (30%)
Tryp_SPc 261..503 CDD:238113 83/280 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.