DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG32271

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:231 Identity:61/231 - (26%)
Similarity:103/231 - (44%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLR-IEQVFAHPNYKKK 234
            ::.|||||::.:.|:|||||.....|.    ||  |.:|...|..|..:.. :::|:....|..:
  Fly    47 NFMCGGSLVTPQHVVTAAHCVKGIGAS----RI--LVVAGVTRLTETGVRSGVDKVYTPKAYNTR 105

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT-----------TIAFAMGYG-ATSFAKPMTN 287
            ....|:|:|||:..:.            .|::.|           .:....|:| .|...|.::.
  Fly   106 TLTSDVAVLKLKAPIS------------GPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSM 158

  Fly   288 RLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH 352
            ::.::::.::|...|.::.    :....:..:..||....: :|.|:||||||...      :| 
  Fly   159 QVRSVDVALIPRKACMSQY----KLRGTITNTMFCASVPGV-KDACEGDSGGPAVY------QG- 211

  Fly   353 RIHYHLIGITSYGVFC-RSSYPSVYTRVS---SFLD 384
                .|.||.|:||.| |.|.|.|||.|.   ||:|
  Fly   212 ----QLCGIVSWGVGCARKSSPGVYTNVKTVRSFID 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 61/231 (26%)
Tryp_SPc 146..386 CDD:214473 61/231 (26%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 59/228 (26%)
Tryp_SPc 25..244 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.