DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG15873

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:74/289 - (25%)
Similarity:119/289 - (41%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DTAVAADANDADFDGRVLARPGEYP-------HMAAV---GFESDRGQVDYKCGGSLISERFVLT 186
            |..|..|.:|..|:  :|...|..|       |:.::   .:...||. ::.|.|.|:|.|.|||
  Fly    20 DLGVIGDISDETFE--MLISGGYKPKSNRLSRHVVSIRTKNYVRHRGD-NHFCSGVLVSSRAVLT 81

  Fly   187 AAHC-TSIYEAP--PKWVRI--GDLD-LA----SEKRSVEAQLLRIEQVFAHPNYK--KKMYYDD 239
            |||| |..|:|.  |:.:|:  |.:. ||    |:.|||       :::..||.|:  ||   :|
  Fly    82 AAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSV-------DRLVVHPEYERYKK---ND 136

  Fly   240 IALLKLEKEVELTEYVRPVRLWVFPELPTTIA--------FAMGYGATSFAKPMTNRLTNLNLTV 296
            :|:|:|.:.|:.:.:.      |.|.|....|        ..:|:|......|.:|.|..|::.:
  Fly   137 LAILRLSERVQSSNHD------VLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVIL 195

  Fly   297 VPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGI 361
            .|.:.|.......      ..:..:|.:. :.....|.||.||||..      :|     .|.|:
  Fly   196 RPPSLCQKHYDTF------TADHNVCTEP-VGESMNCAGDMGGPLLC------KG-----ALFGL 242

  Fly   362 TSYGVFCRSSYPSVYTRVSSFLDWIELTV 390
            ....:.|.......:.....:.|||.||:
  Fly   243 IGGHMGCAGGKAMKFLSFLYYKDWILLTI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 66/270 (24%)
Tryp_SPc 146..386 CDD:214473 65/269 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 62/248 (25%)
Tryp_SPc 59..250 CDD:238113 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.