DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG13430

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:80/270 - (29%)
Similarity:134/270 - (49%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAVAADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSI 193
            |:.|.::.|.:.|||::    .....:||..::...:     .:.|||::||...:||||||...
  Fly    17 TSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGT-----RHACGGTIISPNIILTAAHCVLE 76

  Fly   194 YEAPPKWV-RIGDLDLASEKRSVEAQLLRIEQVFAHPNY-KKKMYYDDIALLKLEKEVELTEYVR 256
            |..|..:| |.|..|...     ....:|::::..||.: ......:|||:::|::.:..::.:|
  Fly    77 YSKPQYYVIRAGSSDWTK-----GGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIR 136

  Fly   257 PVRLWVFPE--LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG---V 316
            |:.|....:  :||...|..|:|:||.::....:  .|..|||...:.|    ..|....|   |
  Fly   137 PISLATSKDIIMPTAQLFVSGWGSTSISQMQPEK--RLRYTVVHLRDQN----QCARNYFGAGTV 195

  Fly   317 LESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSS-YPSVYTRVS 380
            ..:..||......||:|||||||||..::.||.:       |.||.|:|..|.:: :|.:||:||
  Fly   196 TNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLK-------LYGIVSWGFGCANAMFPGIYTKVS 253

  Fly   381 SFLDWIELTV 390
            ::.|||..|:
  Fly   254 AYDDWIAQTI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/252 (29%)
Tryp_SPc 146..386 CDD:214473 73/251 (29%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 72/250 (29%)
Tryp_SPc 32..262 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.