DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG30414

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:247 Identity:76/247 - (30%)
Similarity:107/247 - (43%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHC-------------------TSIYEAPPK-----WVRIGDLDL------ 208
            ||||||:.|||||||||                   .......||     .:|:|:.|.      
  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKD 128

  Fly   209 ASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFA 273
            ....:|.|   |.:::...|.:|...: .:||.||:::..|:.::||||:.|.|...:..:..|.
  Fly   129 CCVPKSYE---LAVDRKILHADYNLNL-DNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFN 189

  Fly   274 M-GYGATSFAKPMTNRLTNLNLTVVPNAE---CNAELPPLAETPSGVLESQICAQDYILNRDTCQ 334
            : |:|.|:...|.    ..|....|.|.:   |.::.....:      ||||||..  .|.|.|.
  Fly   190 ITGWGVTNDGTPS----RRLQRATVYNTDLHFCRSKFTKQVD------ESQICAAG--TNSDACH 242

  Fly   335 GDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            |||||||...:|.........|   |:.|||.....|: ||||.|:...|||
  Fly   243 GDSGGPLSAQVPFAGSWLTFQY---GLVSYGSAACHSF-SVYTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/247 (31%)
Tryp_SPc 146..386 CDD:214473 74/245 (30%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 74/245 (30%)
Tryp_SPc 41..290 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.