DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG32833

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:273 Identity:54/273 - (19%)
Similarity:109/273 - (39%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NDTAVAADANDADFDGRVLARPGEY-------PHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
            :||....|:.:.|.:.......|.:       |.:|::..:...     ||.|::.....::||.
  Fly    18 SDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKA-----KCDGAIYKLSHIVTAG 77

  Fly   189 HCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTE 253
            .|...:......||:|     |..||.....:.:..:..|..:..:..:.::|:|||.:.:|.::
  Fly    78 KCVDGFLNKVIRVRVG-----STTRSDGVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASK 137

  Fly   254 YVRPVRLWVFPELPTTIAFAMGYGATSF-------AKPMTN---RLTNLNLTVVPNAECNAELPP 308
            .::|::|  ..:||:..|.....|..||       .|.:.:   :|....:.::..::|......
  Fly   138 TIQPIQL--ANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWAR 200

  Fly   309 LAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYP 373
            ...:.....:...|.:.:.  ::.|....|.|:..|  |:         |:||.:.| .| |.||
  Fly   201 NNWSKKNFTDDLFCTEKFA--KEACSLAMGSPVVHN--GK---------LVGIITKG-GC-SEYP 250

  Fly   374 SVYTRVSSFLDWI 386
            .||..:..:.||:
  Fly   251 EVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 50/258 (19%)
Tryp_SPc 146..386 CDD:214473 49/256 (19%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 50/251 (20%)
Tryp_SPc 40..262 CDD:214473 48/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.