DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG3700

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:326 Identity:95/326 - (29%)
Similarity:146/326 - (44%) Gaps:57/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADF-DGRVLARPGE 154
            |.|:..|...|.         :|.|..|::..:|.|        |.:......| .|...|...|
  Fly    65 PIPLDHQNLKPA---------EQTRPFEKQCKQYNE--------VRSACQSTPFIVGGTKASGKE 112

  Fly   155 YPHMAAVGF---ESDRGQVDYKCGGSLISERFVLTAAHCTSI-----------YEAPPKWVRIGD 205
            :|.||.:|.   ...:..:::.||||::..:||||||||...           :::|...||:|:
  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGE 177

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNY----KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL 266
            ||..|.......|..|:.....||.|    :::.:.:||||::|:::.|..::|..|.|  .|:.
  Fly   178 LDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL--PPDS 240

  Fly   267 PTTI--AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN 329
            ...:  ..|.|:|.|:.. ..::.|..:||....:..|...|....:|     .:|.||......
  Fly   241 GNDVQQVTAAGWGFTADG-VKSSHLLKVNLQRFSDEVCQKRLRFSIDT-----RTQFCAGSMSSQ 299

  Fly   330 RDTCQGDSGGPLQLNLPGRRRGHRIH---YHLIGITSYGVFCRS-SYPSVYTRVSSFLDWIELTV 390
            .|||.||||||:.:.       |.::   ..:|||.|||:.|.| ..|||||:|..:.||||..|
  Fly   300 ADTCNGDSGGPIFVQ-------HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357

  Fly   391 W 391
            |
  Fly   358 W 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/264 (30%)
Tryp_SPc 146..386 CDD:214473 79/263 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/268 (31%)
Tryp_SPc 102..353 CDD:214473 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.