DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG13527

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:252 Identity:58/252 - (23%)
Similarity:107/252 - (42%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DYKCGGSLISERFVLTAAHCTS-----IYEAPPKWVRIGDLDLASEKRSV-----EAQLLRIEQV 225
            ::.|||.|:|.::|:|||||..     :|:|  :|:    |.:|.....:     ::....:..:
  Fly    59 NHYCGGGLLSNQWVITAAHCVMGQSKIMYKA--RWL----LVVAGSPHRLRYTPGKSVCSPVSSL 117

  Fly   226 FAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF---------------AMG 275
            :...|:.....: ::||:||::::              |.....|.|               .:|
  Fly   118 YVPKNFTMHNTF-NMALMKLQEKM--------------PSNDPRIGFLHLPKEAPKIGIRHTVLG 167

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA--QDYILNRDTCQGDSG 338
            :|...|..|:...:..:::.::.||.|........       :..:||  .::.::.:.|.||.|
  Fly   168 WGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG-------DGMMCAGNNNWTIDAEPCSGDIG 225

  Fly   339 GPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIELTV--WA 392
            .||   |.|:        .::||.:|.:.|. ::.|||||.|.|.|.||..|.  ||
  Fly   226 SPL---LSGK--------VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDWA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 54/243 (22%)
Tryp_SPc 146..386 CDD:214473 53/242 (22%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 55/245 (22%)
Tryp_SPc 43..263 CDD:214473 53/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.