DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG11192

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:280 Identity:85/280 - (30%)
Similarity:134/280 - (47%) Gaps:65/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ADANDADFDGRV----LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAP 197
            |.|.....|||:    :|...|:|:..:|..     |..:.|||::|....|||||||   :|.|
  Fly    17 AGATPTPGDGRIVGGEVATIQEFPYQVSVQL-----QGRHICGGAIIGIDTVLTAAHC---FEDP 73

  Fly   198 PKW------VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVR 256
              |      ||:|    :||..| ...:|.:.:|.||.:|..:.:.:|:|||.|..::..||:::
  Fly    74 --WSSADYTVRVG----SSEHES-GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131

  Fly   257 PVRLWVFPELPT--TIAFAMGYG------ATSFAKPMTNRLTNLNLTVVPNAECN---AELPPLA 310
            ||.|....:.||  |.....|:|      |.|....::.:|..:::.:|.:.:|.   :::.|  
  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP-- 194

  Fly   311 ETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHY-------HLIGITSYGVFC 368
                 :....|||..  ..||:|||||||||            :.|       .|.||.|:|:.|
  Fly   195 -----ITRRMICAAR--PGRDSCQGDSGGPL------------VGYAAEEGPARLYGIVSWGLGC 240

  Fly   369 RS-SYPSVYTRVSSFLDWIE 387
            .: ::|.|||.|::|..||:
  Fly   241 ANPNFPGVYTNVAAFRSWID 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/269 (30%)
Tryp_SPc 146..386 CDD:214473 80/268 (30%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/267 (30%)
Tryp_SPc 28..262 CDD:238113 80/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.