DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss48

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:303 Identity:83/303 - (27%)
Similarity:126/303 - (41%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRG 168
            |.|.||:|.| .:|.:          |..|.......||..        |.:|...::.|:    
Mouse    19 GSFTKKKNLQ-SVCGR----------PVHTGRIVGGQDAAL--------GRWPWQVSLRFD---- 60

  Fly   169 QVDYKCGGSLISERFVLTAAHC------TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFA 227
             ..:.|||||||:.:|||||||      :.:|..   |  :|.:|........|..:.||    |
Mouse    61 -YTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSV---W--LGSIDREYSSTGKEYYVSRI----A 115

  Fly   228 HPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAK------PMT 286
            .|: |.:....|||||||...|..:..:.|:.|   |.:...:........|.:.:      |.|
Mouse   116 IPD-KHRHTEADIALLKLSSRVTFSSVILPICL---PNISKQLTVPASCWVTGWGQNQEGHYPST 176

  Fly   287 NRLTNLNLTVVPNAECNAELPP----LAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPG 347
              |..|.:.|:.:..|.....|    |.:....:.|...||.:....:|:|:|||||||..::.|
Mouse   177 --LQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDG 239

  Fly   348 RRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTV 390
                   .:.|:|:.|:|:.|....|.|||.|:.:..||...:
Mouse   240 -------VWRLMGVVSWGLECGKDLPGVYTNVTYYQKWISAII 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/256 (28%)
Tryp_SPc 146..386 CDD:214473 70/255 (27%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 72/266 (27%)
Tryp_SPc 40..274 CDD:238113 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.