DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:250 Identity:84/250 - (33%)
Similarity:125/250 - (50%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLA 209
            |.|.|....:|...::.:..     .:.||||::...::||||||...|.....| ||.|...|.
  Rat   248 GGVEASADSWPWQVSIQYNK-----QHVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAGSNKLG 307

  Fly   210 SEKRSVEAQLLRIEQVF-AHPN---YKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE--LPT 268
            :      :..|.:.::| |.||   .|:|    ||||:||:..:..:..|||:.|....|  :||
  Rat   308 N------SPSLPVAKIFIAEPNPLQPKEK----DIALVKLKMPLTFSGSVRPICLPFSDEELIPT 362

  Fly   269 TIAFAMGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDT 332
            ...:.:|:|.| .....|::.|...::.|:.:|.||||.....|..:|:|    ||......:||
  Rat   363 MPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGML----CAGTPQGGKDT 423

  Fly   333 CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFLDWI 386
            |||||||||..        |...:.::||.|:|..|.| |.|.|||:|:::||||
  Rat   424 CQGDSGGPLMY--------HYDKWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/249 (33%)
Tryp_SPc 146..386 CDD:214473 82/248 (33%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 82/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.