DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss39

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006244779.1 Gene:Prss39 / 363215 RGDID:1309276 Length:371 Species:Rattus norvegicus


Alignment Length:324 Identity:82/324 - (25%)
Similarity:142/324 - (43%) Gaps:59/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERI------FPNDTAVAAD-----ANDADFDGRV 148
            |.:|.|....|.:...|.         |.::.|:      .|....:.|.     .....|.|::
  Rat    17 PKEPLPATCAGLQALTNT---------STHIGRLAQTNGPCPEGKCLVAGIVSTVCGKTKFQGKI 72

  Fly   149 ----LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDL 208
                :|:...:|..|::.|   ||:  :.||..||.:.:|.:||||......|..: :.:|..:|
  Rat    73 YGGSIAKAERWPWQASLIF---RGR--HICGAVLIDKNWVASAAHCFKRSLKPSDYRILLGYNEL 132

  Fly   209 ASEKRSVEAQLLRIEQVFAHPNYKKKMYYD-DIALLKLEKEVELTEYVRPVRLWVFPELPT---- 268
            ::.  |..::.:.:.:|..|.:|.|....: ||.|::|...|..:.::.||   ..|:..|    
  Rat   133 SNP--SNYSRQMTLSKVIVHEDYNKLHSQEKDIVLIQLHLPVRYSSHIFPV---CVPDQTTKEPS 192

  Fly   269 -TIAFAMGYGATSFAK----PMTNRLTNLNLTVVPNAECNA--ELPPLAETP-SGVLESQICAQD 325
             ...:..|:|..:..|    |..  |.:..:.::.:.||.|  :.|.::.|. ..:.:..|||.|
  Rat   193 DESCWISGWGMVTDDKFLQAPFP--LLDSEVFLMNDQECEAFFQTPQISITEYDAIKDDMICAGD 255

  Fly   326 YILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY--PSVYTRVSSFLDWIE 387
            ....:.||:|||||||...|..       :::|:|:.|:...|....  ||::||||.|.||||
  Rat   256 ITNQKSTCRGDSGGPLVCLLDS-------YWYLVGLASWSGACLEPIHSPSIFTRVSHFSDWIE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/260 (27%)
Tryp_SPc 146..386 CDD:214473 69/259 (27%)
Prss39XP_006244779.1 Tryp_SPc 71..311 CDD:214473 68/258 (26%)
Tryp_SPc 72..314 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.