DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:123/266 - (46%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYK---------CGGSLISERFVLTAAHC--TSIYEAPPK 199
            |..:|.|.:.......|:......|.|:         ||||||::::|::||||  |.|.     
  Rat    11 GVAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKTRIQ----- 70

  Fly   200 WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP 264
             ||:|:.::  .....:.|.:...::..|||:..:...:||.|:||...|:|...|..|      
  Rat    71 -VRLGEHNI--NVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATV------ 126

  Fly   265 ELPTTIAFA------MGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQIC 322
            .||::.|.|      .|:|.| |......:.|..|:..|:|.|:|.|..      |..:..:.||
  Rat   127 ALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASY------PGKITNNMIC 185

  Fly   323 AQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWI 386
            .......:|:||||||||:..|  |:         |.||.|:|..|. ...|.|||:|.:::|||
  Rat   186 VGFLEGGKDSCQGDSGGPVVCN--GQ---------LQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

  Fly   387 ELTVWA 392
            :.|:.|
  Rat   240 QDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/259 (30%)
Tryp_SPc 146..386 CDD:214473 76/258 (29%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 73/246 (30%)
Tryp_SPc 24..242 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.