DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and iotaTry

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:255 Identity:63/255 - (24%)
Similarity:105/255 - (41%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 DANDADFDGRVLARPGEY----PHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPP 198
            ||:|.:..||::....:.    |...::...:     .::|||.:.|:..::||.||........
  Fly    18 DASDVEATGRIIGGSDQLIRNAPWQVSIQISA-----RHECGGVIYSKEIIITAGHCLHERSVTL 77

  Fly   199 KWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL-WV 262
            ..||:|     ::..:....|:.:.....|..:..:..:.|||:|:|...:......|.:.| ..
  Fly    78 MKVRVG-----AQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLAST 137

  Fly   263 FPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYI 327
            .|...||:. ..|:|.|... .:::.|....|.::...||.::  ........|.|..|||..  
  Fly   138 SPSGGTTVT-VTGWGHTDNG-ALSDSLQKAQLQIIDRGECASQ--KFGYGADFVGEETICAAS-- 196

  Fly   328 LNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWI 386
            .:.|.|.|||||||..:           ..|:||.|:|..|. .:||.||..|:....||
  Fly   197 TDADACTGDSGGPLVAS-----------SQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 60/247 (24%)
Tryp_SPc 146..386 CDD:214473 58/245 (24%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 57/244 (23%)
Tryp_SPc 28..247 CDD:238113 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.