DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG12133

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:322 Identity:94/322 - (29%)
Similarity:144/322 - (44%) Gaps:58/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KKENKQRRLCEQK--YSEYVERIFPNDTAVAADANDADFDGRVL--------------ARPGEYP 156
            :|...:.:||...  ..|.|..:|   |.....|.|...|.||.              |:..::|
  Fly    13 QKSQYRNKLCNINPFAHELVHMVF---TCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFP 74

  Fly   157 HMAAVGFE--SDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASE-------- 211
            ....:|:|  :.:.:....|.||||:.|:|||||||.::.:.....||:|:.|..::        
  Fly    75 WTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPN 139

  Fly   212 --KRSVEAQL-LRIEQVFAHPNY--KKKMYYDDIALLKLEKEVELTEYVRPVRLW--------VF 263
              |....|.: :.::....|..|  :...:|:|||||:|:..|:.|..:||:.:|        .|
  Fly   140 GAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSF 204

  Fly   264 PELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL 328
            ...|..||   |:|.:...:..| .|....::.:...||....|.|....    :.||||..:. 
  Fly   205 KNFPFQIA---GWGDSGLQQKST-VLRQGTISGMSPDECLNRYPTLLVDK----DIQICAMGWD- 260

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY---PSVYTRVSSFLDWIE 387
            ..||..||||.||..::   .||....|:|.|||||| ...|||   |:|||:.||:.:||:
  Fly   261 GTDTGLGDSGSPLMASV---GRGADQFYYLAGITSYG-GGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/280 (30%)
Tryp_SPc 146..386 CDD:214473 82/279 (29%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 82/270 (30%)
Tryp_SPc 62..317 CDD:214473 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.