DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and PRSS41

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:253 Identity:77/253 - (30%)
Similarity:123/253 - (48%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MAAVGFESDRGQVD----------YKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASE 211
            :.|.|.||.||:..          ::|||||:|.|:||:||||...:..|.:| |::|:|.....
Human    70 LVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTSRPT 134

  Fly   212 KRSVEAQLLR--IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL----WVFPELPTTI 270
            ..::.|...|  ::.:..:|: ...:..:|||||:|...|....|::|:.:    :.|...|.  
Human   135 PWNLRAYSSRYKVQDIIVNPD-ALGVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPD-- 196

  Fly   271 AFAMGYGATS---FAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG---VLESQICAQDYILN 329
            .:..|:|..|   ...|....|....:|::.|..||.    |.|.||.   :.:|..||.....:
Human   197 CWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNY----LFEQPSSRSMIWDSMFCAGAEDGS 257

  Fly   330 RDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .|||:|||||||..:..|.       ::.:||.|:|:.| :.:.|.|||.:|.:..||
Human   258 VDTCKGDSGGPLVCDKDGL-------WYQVGIVSWGMDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/253 (30%)
Tryp_SPc 146..386 CDD:214473 75/251 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.