DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG1773

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:120/260 - (46%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHMAAVGFESDRGQVDY-KCGGSLISERFVLTAAHCTSIYEAPPK------WVRIGDLDLAS--- 210
            |.||   |....|.::. :|||||:||.||||||||   ::..|:      |  :|:||::|   
  Fly    74 PWMA---FLHISGDIEMCRCGGSLLSELFVLTAAHC---FKMCPRSKEIRVW--LGELDISSTSD 130

  Fly   211 --------------EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLW 261
                          |:.:::..:|..|....:|.|       ||||:||.|:|...:::||:.|.
  Fly   131 CVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY-------DIALIKLNKKVVFKDHIRPICLP 188

  Fly   262 VFPE-LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQ- 324
            :..| |..|:.....|.|..:.:..:.|..|..:.|..|.|         :...|...|.:||. 
  Fly   189 LTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTE---------KCTDGRDTSFLCANG 244

  Fly   325 DYILNRDTCQGDSGGPL--QLNLPGRRRGHRIHYHLIGITSYG-VFCRSSYPSVYTRVSSFLDWI 386
            ||:   |||.|||||||  :..|.|:.|..:     .|:.|.| ..|.:...:.|..|.:::.||
  Fly   245 DYV---DTCTGDSGGPLIWKTTLFGKARTVQ-----FGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301

  Fly   387  386
              Fly   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/260 (30%)
Tryp_SPc 146..386 CDD:214473 77/258 (30%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 77/258 (30%)
Tryp_SPc 62..301 CDD:238113 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.