DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG8170

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:318 Identity:92/318 - (28%)
Similarity:135/318 - (42%) Gaps:74/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 MPGQPFPP----PPGGFK-KKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPG 153
            :|.:.:.|    |..|.. .|:..|||:                  |..|  ||.|        |
  Fly   585 LPQKNYGPVNNEPSCGISLAKQTAQRRI------------------VGGD--DAGF--------G 621

  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--GDLDLASEKRSVE 216
            .:|..|.:...|.|      |||||||.|.|:||.||  :..|.|:.|.:  ||..:.|....:.
  Fly   622 SFPWQAYIRIGSSR------CGGSLISRRHVVTAGHC--VARATPRQVHVTLGDYVINSAVEPLP 678

  Fly   217 AQLLRIEQVFAHPNYKKKMYYD--DIALLKLEKEVELTEYVRPVRLWVFPE----LPTTIAFAMG 275
            |....:.::..||.:|.....|  ||::|.||:.|....::.|:.|   ||    ......:|.|
  Fly   679 AYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICL---PEKNEDFLGKFGWAAG 740

  Fly   276 YGAT---SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG----VLESQICAQDYILNRDTC 333
            :||.   |..:|.|  |..:::.|:.|..|..     ....:|    :.:..:||......:|:|
  Fly   741 WGALNPGSRLRPKT--LQAVDVPVIENRICER-----WHRQNGINVVIYQEMLCAGYRNGGKDSC 798

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFLDWIELTV 390
            ||||||||..:..||       ::|||:.|.|..|.| ..|.:|..||..:||:...|
  Fly   799 QGDSGGPLMHDKNGR-------WYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/256 (30%)
Tryp_SPc 146..386 CDD:214473 77/255 (30%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 83/286 (29%)
Tryp_SPc 612..846 CDD:238113 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.