DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Np

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:226 Identity:71/226 - (31%)
Similarity:113/226 - (50%) Gaps:26/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            :|||.:|::|.:.:|||||  :...||.  .:|:|:.|||.|:.....|..|::.|.:||.:..:
  Fly   825 HKCGAALLNENWAITAAHC--VDNVPPSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPR 887

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI----AFAMGYGATSFAKPMTNRLTNLNLT 295
            .:..|:|||:..:.|.....:.||   ..|:.....    ||..|:|......|:.:.|..:.:.
  Fly   888 TFEYDLALLRFYEPVIFQPNIIPV---CVPDNDENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVP 949

  Fly   296 VVPNAECNAELPPLAETPSGVLES----QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHY 356
            |:.|..|.:     ....:|.:|.    .|||.......|:|:||||||:.|.....:|     :
  Fly   950 VINNTICES-----MYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKR-----F 1004

  Fly   357 HLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ||.|:.|:|:.| .::.|.||||:|.|.|||
  Fly  1005 HLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/226 (31%)
Tryp_SPc 146..386 CDD:214473 69/224 (31%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 69/224 (31%)
Tryp_SPc 798..1038 CDD:238113 71/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.