DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG8586

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:246 Identity:79/246 - (32%)
Similarity:118/246 - (47%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWV-RIGDLDLASEKRSVE 216
            ||:|.|..:    ..|:.::.|||:||..|.|:|.:| ..:.|.....| |.||.||.|......
  Fly   197 GEFPWMVGI----FTGRQEFLCGGTLIHPRLVVTTSH-NLVNETVDTLVARAGDWDLNSLNEPYP 256

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELP-------TTIAFAM 274
            .|..||:::..|..:.....|:|||||.|::.:.|..:::|:.| ..||.|       :...:|.
  Fly   257 HQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCL-PPPESPELTNQLLSVTCYAT 320

  Fly   275 GYGA-TSFAKPMTNRLTNLNLTVVPNAECNAEL-PPLAETPSGVLESQICAQDYILNRDTCQGDS 337
            |:|. .:.:..:.:.|..:||.:|...||.|:| ....|....:..|.|||.. ...:|||:||.
  Fly   321 GWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGG-DPGKDTCKGDG 384

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIE 387
            |.||...:||...    .|.|:||.|:||.|. ...|:||..|.....||:
  Fly   385 GSPLFCQMPGEMD----RYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWID 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/244 (32%)
Tryp_SPc 146..386 CDD:214473 77/243 (32%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 79/246 (32%)
Tryp_SPc 197..430 CDD:214473 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.