DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG30371

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:250 Identity:86/250 - (34%)
Similarity:126/250 - (50%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE---APPKWVRIGDLDLASE 211
            |...|:|.|||:. :..:.|..: |||::::.|::||||||  ||:   |......:|..||.:.
  Fly   156 AAANEFPSMAALK-DVTKNQASF-CGGTIVAHRYILTAAHC--IYQVSRATNIVAIVGTNDLGNP 216

  Fly   212 KRSVEAQLLRIEQVFAHPNY-KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF--- 272
            ..|...|...|:|:..|..| ......:|||:|.....::.:..|.|:.|   |.:.|:..|   
  Fly   217 SSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICL---PPVGTSTPFTYD 278

  Fly   273 ---AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYI-LNRDTC 333
               .:|||...||.|.:..|..:||.||.|.:|..|...:|...:|    |:|..||. ..||:|
  Fly   279 LVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTG----QMCTYDYSGTGRDSC 339

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYP-SVYTRVSSFLDWI 386
            |.|||||:.|     |:..:.   |:||.|||..| .|.|| .|.||::|::.||
  Fly   340 QFDSGGPVIL-----RKSRQF---LVGIISYGKSCAESQYPMGVNTRITSYISWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 85/249 (34%)
Tryp_SPc 146..386 CDD:214473 84/248 (34%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 84/248 (34%)
Tryp_SPc 150..389 CDD:238113 85/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.