DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG14760

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:318 Identity:93/318 - (29%)
Similarity:135/318 - (42%) Gaps:62/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YP-PPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTA-------VAADANDADFD 145
            || ..|.||.      ||             .::|..||...|..:.       :|:..|:.   
  Fly   240 YPTAAPSPGH------GG-------------GRFSCLVEAFQPTCSCGWSRIPRIASPTNEE--- 282

  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC---TSIYEAPPKWVRIGDLD 207
                |...|:|.||.| .....|:|  .||.::|..|::|:||||   .....|....|.:|:.|
  Fly   283 ----AVLHEFPPMAGV-LTKKHGKV--FCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHD 340

  Fly   208 LASEKRSVEAQLLRIEQVFAHPNYKKK--MYYDDIALLKLEKEVELTEYVRPVRLWVFP-----E 265
            |||...:...|...::.:..|.::.:.  ...:|||:||....:..:::|.|..|.:.|     :
  Fly   341 LASSFETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQK 405

  Fly   266 LPTT--IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL 328
            ||..  ...|.|:|.||:..|.|:||....|.|:....|...|    .:..|:.....|.  |..
  Fly   406 LPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQAL----SSAGGLPPHTFCT--YTP 464

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            .|||||.||||.|...:.||...       :||.|:|..|.:..|||.|||:||:.||
  Fly   465 GRDTCQYDSGGALYERINGRLMA-------VGIVSFGQACAAQQPSVNTRVASFIKWI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/253 (32%)
Tryp_SPc 146..386 CDD:214473 78/251 (31%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 80/258 (31%)
Tryp_SPc 281..515 CDD:214473 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.