DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F25E5.7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_872235.1 Gene:F25E5.7 / 353443 WormBaseID:WBGene00017788 Length:379 Species:Caenorhabditis elegans


Alignment Length:275 Identity:54/275 - (19%)
Similarity:91/275 - (33%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KKENK------------QRRLCEQKYSEYVERIFPNDTAVAADAN-DADFDGR----VLARPGEY 155
            :|||:            |||:...|..|    .|.|..||||... ....||:    |:..||..
 Worm    22 EKENQVLQSYCGRTPFLQRRIINGKPLE----AFENPWAVAAQFQYYVQKDGKPKRLVMVFPGTV 82

  Fly   156 -------------PHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLD 207
                         .:....||:.......   .|:.:.|.:.|           |.::....|:.
 Worm    83 ISPYHILTYNLVRSYDGVFGFQHKENMTS---NGTCLGEHYFL-----------PEEYTDRFDII 133

  Fly   208 LASEK----RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT 268
            :...|    |..:..:.|:..:...|:....    .:.:|:|:|.:||...:.||.:...|:|..
 Worm   134 MDRSKFDMTRKFQDLVRRVIVINGCPDVNSA----KVLILELKKPLELNPSIWPVCISNDPQLFD 194

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTC 333
            .        ::.|:....:....||..:.....|:.|.|            ..||:.....:..|
 Worm   195 R--------SSDFSVSGIDAKGVLNSGLFKPVNCSVEGP------------FSCAEAVDNKQRMC 239

  Fly   334 QGDSGGPLQLNLPGR 348
            ..||||....|:.|:
 Worm   240 AYDSGGSAISNVSGQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 39/224 (17%)
Tryp_SPc 146..386 CDD:214473 39/224 (17%)
F25E5.7NP_872235.1 DUF316 2..297 CDD:252150 54/275 (20%)
Tryp_SPc 42..260 CDD:304450 48/255 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.