DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss21

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:310 Identity:87/310 - (28%)
Similarity:140/310 - (45%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEY---PHMAAVGFESDRGQVDYK------- 173
            |..|.:|:.:.|....: .:||       :|:.|..:   |.....|.|::.|:..::       
  Rat    23 QSTSSHVKPVDPEKPEL-QEAN-------LLSGPCGHRTIPSRIVGGEEAELGRWPWQGSLRVWG 79

  Fly   174 ---CGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKRSVEAQLLR--IEQVFAHPNYK 232
               ||.:|::.|:|||||||......|..| |:.|:|.......:::|...|  ||.:|..|.|.
  Rat    80 NHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYT 144

  Fly   233 KKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFA-------MGYGA--TSFAKPMTNR 288
            :: :..|||||||...|..:.:::|:.|     |.:|..||       .|:||  ...:.|:.|.
  Rat   145 EQ-FPHDIALLKLSSPVTYSNFIQPICL-----LNSTYKFANRTDCWVTGWGAIGEDESLPLPNN 203

  Fly   289 LTNLNLTVVPNAECNAELPPLAETPS---GVLESQICAQDYILNRDTC---------QGDSGGPL 341
            |..:.:.::.|..||    .|.:.|.   .:....:||......:|.|         ||||||||
  Rat   204 LQEVQVAIINNTMCN----HLFKKPDFRINIWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPL 264

  Fly   342 QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            ..|       ....::.:|:.|:|:.| |.:.|.|||.:|...:||.||:
  Rat   265 VCN-------QDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIRLTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/278 (28%)
Tryp_SPc 146..386 CDD:214473 77/277 (28%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 74/262 (28%)
Tryp_SPc 58..304 CDD:238113 75/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.