DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG18477

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:119/270 - (44%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSI 193
            |.|...|.....:.|..   ||:..|.|.|.|:   .|.....|..||:||:...|:||...|..
  Fly    95 FVNSKGVTFSFREEDTG---LAQEAEVPWMVAL---LDARTSSYVAGGALIAPHVVITARQRTEN 153

  Fly   194 YEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV 258
            ..|....||.|:.|.:::...:.:..:.|..:..||.:..:...:::||:.|.:.:..:.::.|:
  Fly   154 MTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPI 218

  Fly   259 RLWVFPELPTTIAFA----MGYGATSFAKP-MTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE 318
               ..|..|....|:    .|:|..||..| ..|.|..::|.||....|..:|.........:..
  Fly   219 ---CMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDN 280

  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNL---PGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRV 379
            |.:||... ..:|:|:||.|.||...:   |.|       |.|.||.::||.| ....|:|||.|
  Fly   281 SLMCAGGE-PGKDSCEGDGGSPLACAIKDNPQR-------YELAGIVNFGVDCGLPGVPAVYTNV 337

  Fly   380 SSFLDWIELT 389
            ::.::||.||
  Fly   338 ANVIEWITLT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/249 (27%)
Tryp_SPc 146..386 CDD:214473 67/248 (27%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 66/244 (27%)
Tryp_SPc 113..344 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.