DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:327 Identity:85/327 - (25%)
Similarity:129/327 - (39%) Gaps:76/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GFKKKENKQRRLCEQKYSEYV---ERIFP--NDTAV---------AADAND-ADFDGRVLARPGE 154
            ||:..||.:.   ||..::.:   .|.|.  ||...         ..|..| :|.:|...:|...
Human   540 GFRDCENGRD---EQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSSS 601

  Fly   155 YPHMAAVGFESDRG----QVDYK------CGGSLISERFVLTAAHC--TSIYEAPPKWVRIGDLD 207
            ..|....|.::..|    ||...      ||.|:||..::|:||||  .:....|..|.....:.
Human   602 ALHRIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMY 666

  Fly   208 LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLE---KEVELTEYVRPV----------- 258
            :....:.|..    :.::..|..|..:.:..|||||:|.   .|. |.:.::|:           
Human   667 VQGNAKFVSP----VRRIVVHEYYNSQTFDYDIALLQLSIAWPET-LKQLIQPICIPPTGQRVRS 726

  Fly   259 --RLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ- 320
              :.||           .|:|       ..:...|....|:..||.......|..:..|::.|: 
Human   727 GEKCWV-----------TGWG-------RRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRM 773

  Fly   321 ICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLD 384
            :||......||.|:|||||||..     ||.....:.|.||.|:|... |.::|.||||||:|:.
Human   774 LCAGIMSGKRDACKGDSGGPLSC-----RRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVP 833

  Fly   385 WI 386
            ||
Human   834 WI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/271 (27%)
Tryp_SPc 146..386 CDD:214473 70/269 (26%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.