DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG3355

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:296 Identity:95/296 - (32%)
Similarity:136/296 - (45%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFPNDTAVAA----------DANDADFDG-----RVL----ARPGEYPHMAAVGFE 164
            |::::.|:.:.|.:.::.|          .|....|.|     |::    .|..:||..|.:  .
  Fly    32 QQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQL--V 94

  Fly   165 SDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHP 229
            ..|......||||||::|:|||||||.. .......:|:..:|.:|....:   :.::.|...||
  Fly    95 KGRHYPRLFCGGSLINDRYVLTAAHCVH-GNRDQITIRLLQIDRSSRDPGI---VRKVVQTTVHP 155

  Fly   230 NYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE----LPTTIAFAMGYGATSFAKPMTNRLT 290
            ||......:|:||||||..|.||..:|||.|   ||    .....|...|:|........:|.|.
  Fly   156 NYDPNRIVNDVALLKLESPVPLTGNMRPVCL---PEANHNFDGKTAVVAGWGLIKEGGVTSNYLQ 217

  Fly   291 NLNLTVVPNAECNAELPPLAETPSGVLESQICA----QDYILNRDTCQGDSGGPLQLNLPGRRRG 351
            .:|:.|:.||:|..     ......:.|..:||    |.   .:|.|||||||||.:| .||   
  Fly   218 EVNVPVITNAQCRQ-----TRYKDKIAEVMLCAGLVQQG---GKDACQGDSGGPLIVN-EGR--- 270

  Fly   352 HRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
                |.|.|:.|:|..| :.:.|.||.|||.|||||
  Fly   271 ----YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 89/259 (34%)
Tryp_SPc 146..386 CDD:214473 87/257 (34%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 86/251 (34%)
Tryp_SPc 76..305 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.