DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG4271

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:105/231 - (45%) Gaps:55/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            ::|||::|..|.|||||.|  :...|.|  .||:|..|:....|     ::|:..:..|.|||. 
  Fly    42 HECGGAVIDSRIVLTAAQC--VKNKPVKRITVRVGTPDIYRGGR-----IIRVTALVVHENYKN- 98

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFP---------ELPTTIAFAMGYG---ATSFAKPMTN 287
             :.:|||||.|||.      |..||:...|         |.|:.    .|:|   ..|:.  :|.
  Fly    99 -WDNDIALLWLEKP------VLSVRVTKIPLATKEPSENEYPSN----AGWGEKLLESYV--VTR 150

  Fly   288 RLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH 352
            :|.|....:.|.:.|..||    ..|.|  |..:||  :....|.|.||.||||.|       .:
  Fly   151 KLQNGVTKIRPRSMCAEEL----VEPVG--EELLCA--FYTENDICPGDYGGPLVL-------AN 200

  Fly   353 RIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIE 387
            ::    :||...|..|. :..||:||.|..:|:|||
  Fly   201 KV----VGIAVQGHGCGFAVLPSLYTNVFHYLEWIE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/229 (31%)
Tryp_SPc 146..386 CDD:214473 71/228 (31%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 74/231 (32%)
Tryp_SPc 19..231 CDD:214473 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.