DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Send1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:219 Identity:60/219 - (27%)
Similarity:101/219 - (46%) Gaps:34/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM 235
            ::.||||:.|:..::|||||....|   :.:|.|     |........::.:|....||.:.|..
  Fly    52 EHFCGGSIYSKTIIITAAHCIKEGE---RSIRAG-----SSLHDSGGVVVGVEAYIIHPQFDKHN 108

  Fly   236 YYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSF-AKPMTNRLTNLNLTVVPN 299
            ..:|:|:|||...:..::.::.:.|.......::.|.|.|:|..:| .:|  .:|..:.:.:.|.
  Fly   109 MENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGRGNFLIRP--RQLQGVEILIRPL 171

  Fly   300 AECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY 364
            ..|..:.      .:||....|||..  :.:..|.|||||||..|  |:         |:||||.
  Fly   172 IVCKLKY------GNGVFNEDICAGR--MGKGGCYGDSGGPLVFN--GQ---------LVGITSR 217

  Fly   365 --GVFCRSSYPSVYTRVSSFLDWI 386
              .:.|..|  |:|..|:.:.:||
  Fly   218 TGNIVCLGS--SLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 60/219 (27%)
Tryp_SPc 146..386 CDD:214473 58/217 (27%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 58/217 (27%)
Tryp_SPc 30..239 CDD:238113 58/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.