DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG1304

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:275 Identity:69/275 - (25%)
Similarity:119/275 - (43%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIY 194
            ||...:.....:|||:    |...::||..::     |....:.||||::|..:|||||||.:..
  Fly    18 AVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSL-----RNAGSHSCGGSILSRNYVLTAAHCVTNQ 77

  Fly   195 EAPPKWVRIGDLDLASEKRSVEA---------QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVE 250
            ::....|.|     |:|:.::.|         .|:::.:|..|..|..  :.:|:|||:||..:.
  Fly    78 DSNGNSVPI-----AAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLI 135

  Fly   251 LTEYVRPVRLWVFPELPTTIAFA------MGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPL 309
            |:..::|:      :|||....|      .|:|.......:...|....|..:....|:      
  Fly   136 LSASIQPI------DLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCD------ 188

  Fly   310 AETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CRSSY 372
             |.....::|::|. .:..:...|.||||||...|           ..::|:..: |:  |.:||
  Fly   189 -ELIGWGVQSELCL-IHEADNGACNGDSGGPAVYN-----------NQVVGVAGF-VWSACGTSY 239

  Fly   373 PSVYTRVSSFLDWIE 387
            |..|.||....:||:
  Fly   240 PDGYARVYYHNEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 66/261 (25%)
Tryp_SPc 146..386 CDD:214473 65/260 (25%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 64/259 (25%)
Tryp_SPc 32..256 CDD:238113 65/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.