DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Ser6

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:114/263 - (43%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205
            :|||:    |...::||..::     |....:.||||:::..::||||||.|..:     |....
  Fly    29 NGRVVGGEDAVKNQFPHQVSL-----RNAGSHSCGGSILTRTYILTAAHCVSNED-----VNHVI 83

  Fly   206 LDLASEKRSVEA---------QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLW 261
            ..:|:|:.::.|         .|:::.:|..|..|..  :.:|:|||:||..:.|:..::|:   
  Fly    84 TPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLILSASIQPI--- 143

  Fly   262 VFPELPTTIAFA------MGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ 320
               :|||....|      .|:|.......:...|....|..:...:|. ||....      .|.:
  Fly   144 ---DLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCE-ELIDFG------FEGE 198

  Fly   321 ICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV-FCRSSYPSVYTRVSSFLD 384
            :|....:.| ..|.||||||...|           ..|:|:..:.| .|.|:||..|.||..|.|
  Fly   199 LCLLHQVDN-GACNGDSGGPAVYN-----------NQLVGVAGFVVDGCGSTYPDGYARVFYFKD 251

  Fly   385 WIE 387
            ||:
  Fly   252 WIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/260 (27%)
Tryp_SPc 146..386 CDD:214473 68/259 (26%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 67/258 (26%)
Tryp_SPc 32..256 CDD:238113 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.