DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012817

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_560999.5 Gene:AgaP_AGAP012817 / 3292527 VectorBaseID:AGAP012817 Length:439 Species:Anopheles gambiae


Alignment Length:351 Identity:88/351 - (25%)
Similarity:130/351 - (37%) Gaps:119/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 KQRR-LCE-QKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDY-- 172
            :||. ||: .||:.|.      |.|......|...|.|||.            |::|..:|||  
Mosquito   124 RQRTGLCDPSKYTAYA------DVAKYLGWIDQYIDRRVLV------------FDTDELEVDYEE 170

  Fly   173 ---------------------------------------KCGGSLISERFVLTAAHCTSIYEAPP 198
                                                   ||..:||||.:|:..|.|   :|...
Mosquito   171 KLPLFNLNTCGTKSETVLDNGQPAPLPWLGFVLTKEEKVKCVVTLISEWYVVGTASC---FEKNE 232

  Fly   199 KWVRI---GDLDLASEK---------RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVEL 251
            |.:||   |..||..:|         .:...|...|.:|.|||.:.|....|:|||::|:...:.
Mosquito   233 KDLRILFGGYEDLLEQKCFERNGSTVCAYPTQSRSIGRVVAHPRFSKNTINDNIALIELQSPADT 297

  Fly   252 TE-YVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNL--------TVVPNAECNAELP 307
            |: :|:|:.|.|.|.|                  .|||..|.::        |:|..:..:.: |
Mosquito   298 TQPHVKPICLPVTPTL------------------YTNRTENFSVLAFRLTTGTIVDQSVNHVD-P 343

  Fly   308 PLAETPSGVL-------ESQICA---QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGIT 362
            ...::...|.       |...|.   ::.:.|.|:..| .|.|||.::.....|.|  |.|.|..
Mosquito   344 DFCKSVHIVAGFAIDNEEKSFCVSVPEEDVANCDSLLG-QGTPLQEHVSMVNAGER--YVLRGFD 405

  Fly   363 SYGVFCR--SSYPSVYTRVSSFLDWI 386
            ..|:.|.  ||.|.:|..|.|:|||:
Mosquito   406 LLGLTCAGDSSIPVLYVNVYSYLDWM 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/315 (24%)
Tryp_SPc 146..386 CDD:214473 76/313 (24%)
AgaP_AGAP012817XP_560999.5 Tryp_SPc <1..150 CDD:238113 9/31 (29%)
Tryp_SPc 190..430 CDD:214473 67/264 (25%)
Tryp_SPc 190..430 CDD:304450 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.