DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP009006

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552907.3 Gene:AgaP_AGAP009006 / 3291875 VectorBaseID:AGAP009006 Length:401 Species:Anopheles gambiae


Alignment Length:284 Identity:82/284 - (28%)
Similarity:136/284 - (47%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEYVERIFPNDTAVAADANDADFDG-RVLARP---GEYPHMAAVGFESDRGQVDYKCGGS 177
            ||..|..:.::.             |||.| |..|:|   |.:||...:|::.::....:.|.|:
Mosquito   157 CETNYQRFRKKY-------------ADFVGDRGTAQPLEDGAHPHSVMIGWKVNKTATAWHCTGT 208

  Fly   178 LISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVE--AQLLRIEQVFAHPNYKKKMYYDDI 240
            ||:...|||.|.|.::       |.:|:.::|   |..:  ||::|:::...:|:|..|.:.:||
Mosquito   209 LINLNTVLTTAGCANM-------VSVGETNVA---RIYDGAAQIIRVKETIRYPSYNAKTHDNDI 263

  Fly   241 ALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAE 305
            |:||||.:|.:.|...|..||  .:|..|..:  |.......:.:|.|..|    ||.|.:|.  
Mosquito   264 AVLKLESDVLVNENAIPACLW--RDLNRTPYY--GQEVHFDGQSLTARDKN----VVHNRDCQ-- 318

  Fly   306 LPPLAETPSGVLESQICAQDYILNRD-----TCQGDSGGPLQLNLPGRRRGHRIHY-HLIGITSY 364
               |..:.:.:...|:|.|::.|..|     .| |..|.|. :.|   :|.:.|:. :|:|:.||
Mosquito   319 ---LFTSHTELTNDQLCWQEFRLRPDGADAPNC-GRKGNPF-ITL---QRTNNIYLPYLVGLYSY 375

  Fly   365 GVFCRSSYPSVYTRVSSFLDWIEL 388
            ...|....|.|.||:||:::||.|
Mosquito   376 DRQCAGGEPIVATRISSYINWISL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/252 (29%)
Tryp_SPc 146..386 CDD:214473 73/251 (29%)
AgaP_AGAP009006XP_552907.3 Tryp_SPc <1..64 CDD:304450
Tryp_SPc 184..398 CDD:304450 70/241 (29%)
Tryp_SPc 184..397 CDD:214473 69/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.