DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:229 Identity:72/229 - (31%)
Similarity:112/229 - (48%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            :|||.:|::|.:.:|||||  :...||.  .:|:|:.|||.|:.....|..|::.|.:||.:..:
Mosquito    34 HKCGAALLNENWAITAAHC--VDNVPPSDLLLRLGEYDLALEEEPYGYQERRVQIVASHPQFDPR 96

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI----AFAMGYGATSFAKPMTNRLTNLNLT 295
            .:..|:|||:..:.|.....:.||   ..||.....    ||..|:|......|:.:.|..:.:.
Mosquito    97 TFEYDLALLRFYEPVVFQPNIIPV---CVPENDENFIGRTAFVTGWGRLYEDGPLPSVLQEVTVP 158

  Fly   296 VVPNAECNAELPPLAET---PSGVLES----QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHR 353
            |:.|..|        ||   .:|.:|.    .|||.......|:|:||||||:.:....:|    
Mosquito   159 VIENNIC--------ETMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVIQRTDKR---- 211

  Fly   354 IHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
              :.|.|:.|:|:.| ..:.|.||||:|.|.|||
Mosquito   212 --FLLAGVISWGIGCAEPNQPGVYTRISEFRDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/229 (31%)
Tryp_SPc 146..386 CDD:214473 70/227 (31%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 70/227 (31%)
Tryp_SPc 7..246 CDD:238113 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.