DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPC1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:433 Identity:128/433 - (29%)
Similarity:194/433 - (44%) Gaps:106/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLSVCLISF----------IGLWCLSNTHTQRLPPEGRMR------PLQDDSIRSP--------- 43
            ::::|:|.|          :|..|:    .||....|..|      |:.|| ||:.         
Mosquito    10 SVALCVILFVIATVRCDLEVGDPCI----VQRTNEPGICRIVSECAPVIDD-IRNRRGNPTKCGF 69

  Fly    44 VDR--DIVFPELDAGPGKPEEKMWFHITDFQFDRVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGF 106
            :||  .:..|::...|.                   ..|.|...||                   
Mosquito    70 IDRVQIVCCPQVGTTPA-------------------AATTPSTTPR------------------- 96

  Fly   107 KKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADF---------------DGRVLARPGEYP 156
                |:.:|:.| |.:||.:.:|..:...:..|::...               ||. ||:..|:|
Mosquito    97 ----NEHQRVAE-KCAEYGQAVFSKEYVNSLTASEPKLQTIDKCGHTAVELIVDGE-LAKAREFP 155

  Fly   157 HMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-TSIYEAPPKWVRIGDLDLASEKRSVEAQLL 220
            |||.:|| .:..::.|.|||||:|:||:|||.|| ||....|...||:|:|.|||.......:..
Mosquito   156 HMALIGF-GEAPEIRYLCGGSLVSDRFILTAGHCLTSTNFGPATIVRLGELSLASSTDEAFPEDY 219

  Fly   221 RIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPM 285
            .|.:...||.||:..:|:||||:||.::|..:.|.||:.|.:...:|...|.|.|:||..|....
Mosquito   220 DIAERIPHPEYKQTSHYNDIALIKLNRKVIFSPYARPICLPLQAAIPQKRAIATGWGAIGFGLEQ 284

  Fly   286 TNRLTNLNLTVVPNAECNAELPPLAETPSGV-LESQICAQDYILNRDTCQGDSGGPLQL----NL 345
            ::.|..:.|.:....||..:..|..:..:|: ..:|:||......:||||||||||||:    |:
Mosquito   285 SSALLKVTLDMFRFEECKDQFEPTRKLRTGLNATTQLCAGSRNSTKDTCQGDSGGPLQVYNDANV 349

  Fly   346 PGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
                   ...|.:||:||:|..| .:..|:|||.|.|:|.|||
Mosquito   350 -------YCTYTIIGVTSFGQNCGLAGVPAVYTTVYSYLSWIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 95/247 (38%)
Tryp_SPc 146..386 CDD:214473 94/246 (38%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829 9/40 (23%)
Tryp_SPc 143..386 CDD:238113 98/252 (39%)
Tryp_SPc 143..384 CDD:214473 95/249 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.