DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TRY2_ANOGA

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_555167.1 Gene:TRY2_ANOGA / 3291694 VectorBaseID:AGAP008295 Length:277 Species:Anopheles gambiae


Alignment Length:246 Identity:75/246 - (30%)
Similarity:115/246 - (46%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 HMAAVGFESDRGQVDY----------KCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASE 211
            |....||:.|.....|          :||||::..::||||||||...:.....||:|     |.
Mosquito    49 HRVVGGFQIDVSDAPYQVSLQYFNSHRCGGSVLDNKWVLTAAHCTQGLDPSSLAVRLG-----SS 108

  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE-----LPTTIA 271
            :.:....|:.:.:...||.|.......|.:|::||.|:..::.|:||.|   ||     .|.|:|
Mosquito   109 EHATGGTLVGVLRTVEHPQYDGNTIDYDFSLMELETELTFSDAVQPVEL---PEHEEPVEPGTMA 170

  Fly   272 FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGD 336
            ...|:|.|..|...::.|...|:..|.:.:|:.......|    :.:..:||......:|.||||
Mosquito   171 TVSGWGNTQSAVESSDFLRAANVPTVSHEDCSDAYMWFGE----ITDRMLCAGYQQGGKDACQGD 231

  Fly   337 SGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |||||..:  |:         |:|:.|:|..| :..||.||.||:|..||:
Mosquito   232 SGGPLVAD--GK---------LVGVVSWGYGCAQPGYPGVYGRVASVRDWV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/246 (30%)
Tryp_SPc 146..386 CDD:214473 74/244 (30%)
TRY2_ANOGAXP_555167.1 Tryp_SPc 50..271 CDD:214473 73/243 (30%)
Tryp_SPc 51..274 CDD:238113 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.