DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TRY3_ANOGA

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_317171.2 Gene:TRY3_ANOGA / 3291693 VectorBaseID:AGAP008294 Length:268 Species:Anopheles gambiae


Alignment Length:258 Identity:80/258 - (31%)
Similarity:122/258 - (47%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RVLARPG-EYPHMAAVGFESDRGQVDY----------KCGGSLISERFVLTAAHCTSIYEAPPKW 200
            |.|.||. :..|....|||.|..:..|          :||||:::.:::|||||||...:.....
Mosquito    29 RFLPRPKYDVGHRIVGGFEIDVSETPYQVSLQYFNSHRCGGSVLNSKWILTAAHCTVNLQPSSLA 93

  Fly   201 VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE 265
            ||:|     |.:.:....::|:.:|..||||.......|.:|::||.|:..::.|:||.|   |:
Mosquito    94 VRLG-----SSRHASGGTVVRVARVLEHPNYDDSTIDYDFSLMELESELTFSDVVQPVSL---PD 150

  Fly   266 LPT-----TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPS-GVLESQICAQ 324
            ...     |:....|:|.|..|......|...|:..|...||.     :|.:.| |:.:..:||.
Mosquito   151 QDEAVEDGTMTIVSGWGNTQSAAESNAILRAANVPTVNQKECT-----IAYSSSGGITDRMLCAG 210

  Fly   325 DYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .....:|.|||||||||.::  |:         |:|:.|:|..| ...||.||.||:...||:
Mosquito   211 YKRGGKDACQGDSGGPLVVD--GK---------LVGVVSWGFGCAMPGYPGVYARVAVVRDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/258 (31%)
Tryp_SPc 146..386 CDD:214473 79/256 (31%)
TRY3_ANOGAXP_317171.2 Tryp_SPc 41..262 CDD:214473 74/244 (30%)
Tryp_SPc 42..265 CDD:238113 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.