DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:288 Identity:79/288 - (27%)
Similarity:121/288 - (42%) Gaps:86/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IFPNDTAVAADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVD-YKCGGSLISERFVLTA 187
            |||   |.||..|     ||::    |..|:.|.|.::     |..:: :.|||:|:|.||||::
Mosquito    12 IFP---AFAAGPN-----GRIVGGIDAVAGDAPWMVSL-----RNSINQHLCGGTLLSNRFVLSS 63

  Fly   188 AHCTSIYEAPPKWVRIGDLDLA-SEKRSVEAQLLRIE--QVFAHPNYKKKMYYDDIALLKLEKEV 249
            |:|.|        .|:....:| :..|.:....:...  |:..|||:.......|:||.:...:.
Mosquito    64 ANCLS--------GRLATATMAVAGSRFLNTAAIPYYGIQIITHPNFNVNTLEHDVALFQTALQF 120

  Fly   250 ELTEYVRP-----------VRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC- 302
            .||:.|:|           ||..||           |:||:......||.|..||:..:.|.:| 
Mosquito   121 ILTQSVQPLPLSADVIGVGVRARVF-----------GWGASQANGGNTNALQFLNVNTLSNDDCA 174

  Fly   303 ---NAE---LPPLAETPSGVLESQICAQDYILNRD---TCQGDSGGPLQLNLPGRRRGHRIHYHL 358
               .||   :.|          |.:|.    |.|:   .|.||.||.|.|:           .:.
Mosquito   175 NFLGAEGWRIGP----------SSLCT----LTREGQGICGGDEGGALVLD-----------NYA 214

  Fly   359 IGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            ||:.|:|:.|.:..|.|:.|:|:...||
Mosquito   215 IGVASWGIPCATGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/270 (27%)
Tryp_SPc 146..386 CDD:214473 70/268 (26%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 69/267 (26%)
Tryp_SPc 24..242 CDD:238113 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.