DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011909

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320620.4 Gene:AgaP_AGAP011909 / 3291449 VectorBaseID:AGAP011909 Length:400 Species:Anopheles gambiae


Alignment Length:246 Identity:68/246 - (27%)
Similarity:106/246 - (43%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQ 218
            |:|.|||:...|..|:..: ||.::|:....:|||||..........:.:|:.|:.:...|....
Mosquito   165 EFPMMAALVDGSKSGEGIF-CGATIITNYHAVTAAHCYMGRSIANLALLVGEHDITTGSESPYTA 228

  Fly   219 LLRIEQVFAHPNYKK--KMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF--------- 272
            ||.:..:..|..|..  ....:|||:::...|:.....|.|..|        .|.|         
Mosquito   229 LLLLASIKIHEGYSSTTSSSSNDIAIVRTRTEILFNAGVGPACL--------PIKFVGASFVGIQ 285

  Fly   273 --AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQG 335
              |:|:|...:..|.:|....:.|.||..::|:|..|..:      .:.|:|.  ...|:||||.
Mosquito   286 LEAVGWGTLDYGAPKSNVPMKVALPVVNPSQCSALYPTFS------AQQQLCT--LTPNKDTCQS 342

  Fly   336 DSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            ||||||.......:|.     :|:|...||:.|.:..|||.|.|..:..||
Mosquito   343 DSGGPLFYTDAYNKRA-----YLLGTIGYGIACATDRPSVSTNVLYYTQWI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/246 (28%)
Tryp_SPc 146..386 CDD:214473 66/244 (27%)
AgaP_AGAP011909XP_320620.4 CUB 52..123 CDD:294042
Tryp_SPc 154..388 CDD:214473 66/244 (27%)
Tryp_SPc 155..391 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.