DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPA14

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552456.2 Gene:CLIPA14 / 3291432 VectorBaseID:AGAP011788 Length:281 Species:Anopheles gambiae


Alignment Length:183 Identity:51/183 - (27%)
Similarity:75/183 - (40%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQK--YSEYVERIFPNDTAVAADANDAD 143
            :|.|...:.||..:|..  ..|..|.:.:.....|:..||  .|||                   
Mosquito   129 EPPPSATKAPPTSVPDA--RRPTCGMRNENGIGFRIEGQKDGESEY------------------- 172

  Fly   144 FDGRVLARPGEYPHMAAVGFE---SDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205
                     ||:|.|.||..|   :|.....|:||.|||:...|||||||....:.....:|.|:
Mosquito   173 ---------GEFPWMLAVLREERVADSNLNVYECGASLIAPNVVLTAAHCVFNKQKEQLLIRAGE 228

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV 258
            .|..:.....:.|..|:.:|..|..:.|....:|:|||.|.:..:|.|.|:|:
Mosquito   229 WDTQTRNELYQHQDRRVAEVITHEAFNKASLANDVALLILTEPFQLAENVQPI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 38/116 (33%)
Tryp_SPc 146..386 CDD:214473 38/116 (33%)
CLIPA14XP_552456.2 Tryp_SPc 169..>281 CDD:304450 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.