DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011608

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_552668.3 Gene:AgaP_AGAP011608 / 3291375 VectorBaseID:AGAP011608 Length:314 Species:Anopheles gambiae


Alignment Length:255 Identity:67/255 - (26%)
Similarity:111/255 - (43%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-----TSIYEAPPKWVRIGDLDLA 209
            |..|.:|...||..    |...: |||:::::..:||||.|     ..:..|....||.|.|.: 
Mosquito    46 AMAGAFPAQVAVQI----GTAAF-CGGTILNQNHILTAAGCVLDANNHLIAANQVTVRAGVLVV- 104

  Fly   210 SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP------VRLWVFPELPT 268
                ...|.::.:.::|.||.|....:.:|||:|:|...:...:...|      :.|.:.|:  :
Mosquito   105 ----DQNAPVMAVNRIFPHPQYNPWTFENDIAVLRLTNNIVFPQVALPNMAPAELNLRIVPD--S 163

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL-ESQICAQDYILNRDT 332
            |:...:|:.....|:.:.  |..||:...|...|||:       ..|:| :|..|.   :||:.|
Mosquito   164 TVCQVLGWNWQQAAQNVP--LQVLNVQYSPRTTCNAQ-------HQGMLHDSMACT---VLNQAT 216

  Fly   333 ---CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC--RSSYPSVYTRVSSFLDWIE 387
               |..:.||.|..|           ..|.||.|:|..|  .::| :|||:|..:..||:
Mosquito   217 HGVCAPNRGGGLYCN-----------DLLTGIISFGFGCGTNNTY-TVYTQVRYYHHWIQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 66/253 (26%)
Tryp_SPc 146..386 CDD:214473 65/252 (26%)
AgaP_AGAP011608XP_552668.3 Tryp_SPc 41..266 CDD:238113 67/255 (26%)
Tryp_SPc 41..263 CDD:214473 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.