DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:330 Identity:88/330 - (26%)
Similarity:138/330 - (41%) Gaps:79/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YPPP------PMPGQPFPPPPGGFKKKENKQRRLCEQ-----------------KYSEYVERIFP 130
            |.||      |:.....|||            |.|.|                 .|..|:.....
Mosquito    26 YKPPSFGVETPISSTMKPPP------------RDCSQCCMYTRCMLLGHVIKVPTYFLYLTACGR 78

  Fly   131 NDTA---VAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS 192
            ..|:   |..||.|..          |||.:..:.:   ||.  :.||||||::|:::|||||..
Mosquito    79 GKTSSRIVGGDAADVK----------EYPWIVMLLY---RGA--FYCGGSLINDRYIVTAAHCVL 128

  Fly   193 IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
            .:.......::.|::..      |.....|.:::.|..:....:.:||||:||::.||......|
Mosquito   129 SFTPQQLLAKLYDVEHG------EMVTRAIVKLYGHERFSLDTFNNDIALVKLQQPVEAGGSFIP 187

  Fly   258 VRLWV----FPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE 318
            :.|.|    |.....|:   :|:|..:... ::..|....:.::.|.:|...    :...|.:.:
Mosquito   188 ICLPVAGRSFAGQNGTV---IGWGKLANGS-LSQGLQKAIVPIISNMQCRKS----SYRASRITD 244

  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSF 382
            :.:||......||.|||||||||.:       |......|:||.|:|..| |.:||.|||||:.:
Mosquito   245 NMLCAGYTEGGRDACQGDSGGPLNV-------GDSNFRELVGIVSWGEGCARPNYPGVYTRVTRY 302

  Fly   383 LDWIE 387
            |:||:
Mosquito   303 LNWIK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/245 (29%)
Tryp_SPc 146..386 CDD:214473 69/244 (28%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 73/257 (28%)
Tryp_SPc 85..309 CDD:238113 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.