DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:257 Identity:83/257 - (32%)
Similarity:121/257 - (47%) Gaps:40/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK 212
            ||||::|:..|:  .|.|..|    .||.|:|::|:|||||||..|.......|..|...|.:..
Mosquito    72 ARPGQFPYQVALLGQFNSGVG----LCGASIITQRYVLTAAHCVYIGVDASTPVANGTAILGAHN 132

  Fly   213 RSVEAQ-----LLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF 272
            |.:|..     ......|..||.|......:|||:::|::.:..|:.::|:||   |....|..|
Mosquito   133 RMIEEPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPILYTDRIQPIRL---PGRSDTRTF 194

  Fly   273 A------MGYGATSFAKPMTNRLTNLNLT-VVPNAECNAELPPLAETPSG---VLESQICAQDYI 327
            |      .|||..|.|.|..:.:.|..|. |:.||:|.|..       ||   ::|.|...|...
Mosquito   195 AGLMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCRAAW-------SGFEWLIEPQNVCQSGD 252

  Fly   328 LNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CRSSYPSVYTRVSSFLDWIE 387
            ..|..|..||||||.:    :..|..:.   :|:.|:|..  |.:..|:|:.||:.:|||||
Mosquito   253 GGRSACNSDSGGPLTV----QDNGESLQ---VGVVSFGSAGGCDNGIPTVFARVTYYLDWIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/255 (32%)
Tryp_SPc 146..386 CDD:214473 80/254 (31%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 80/254 (31%)
Tryp_SPc 66..309 CDD:238113 83/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.